PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009610486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 257aa    MW: 29547.3 Da    PI: 7.8865
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009610486.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.8e-161463148
                     TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++++ ++G+   +W t +++ g++R++k+c++rw++yl
   XP_009610486.1 14 RGQWSPEEDEILKNYILKYGTSagNWITLPHRAGLKRCGKSCRLRWLNYL 63
                     89******************99**************************97 PP

2Myb_DNA-binding49.69.2e-1670112246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g++T eEd ++  + +qlG++ W+ Ia++++ gRt++++k++w++
   XP_009610486.1  70 GNFTREEDNIICSLYTQLGSR-WSIIASKLP-GRTDNDVKNHWNT 112
                      79*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.191963IPR017930Myb domain
SuperFamilySSF466895.24E-2712110IPR009057Homeodomain-like
SMARTSM007172.4E-101365IPR001005SANT/Myb domain
PfamPF002496.3E-141463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-221570IPR009057Homeodomain-like
CDDcd001675.40E-81763No hitNo description
PROSITE profilePS5129423.07464118IPR017930Myb domain
SMARTSM007175.4E-1368116IPR001005SANT/Myb domain
PfamPF002491.6E-1270112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2371118IPR009057Homeodomain-like
CDDcd001672.01E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRTPCCDKT KVKRGQWSPE EDEILKNYIL KYGTSAGNWI TLPHRAGLKR CGKSCRLRWL  60
NYLRPDIKLG NFTREEDNII CSLYTQLGSR WSIIASKLPG RTDNDVKNHW NTKLKKKLLT  120
PNANPTNNFD DSKQVFHSSS MVPKEEEQQA AYSPIQFPFP NWDSAGFSSI LNNNKNMVQH  180
DQKQFPLSRF TQDYSKISTS REESMIFGSS SVEMHENIDL AWFNTFEGFP MGDEIMGAGI  240
WNQQSVLEDI DFPVTFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141207110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610486.10.0PREDICTED: transcription factor RAX1-like
SwissprotQ9FG685e-62RAX1_ARATH; Transcription factor RAX1
TrEMBLK4CLH08e-77K4CLH0_SOLLC; Uncharacterized protein
STRINGSolyc08g065910.1.12e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.12e-58myb domain protein 87